Developer API Reference
The Nilus Lab REST API provides biotechnology research institutions with programmatic access to the Zenith v31 foundation engines. Integrate cellular reprogramming models, methylation-based biological clocks, protein structure folds, and targeted LNP formulations directly into your bioinformatics pipelines.
1. Installation & Environment
Use standard packages like HTTP libraries and binary file handling tools to communicate with the REST API. For scientific matrix serialization, you will need the standard python libraries:
pip install requests numpy pandas anndata cellxgene-census
2. Authentication
All requests to the Zenith API must contain the standard developer header X-API-Key. Keys are issued through the Nilus Lab Console for validated institutional research credentials. Keep private keys secure; do not share them in frontend repositories.
X-API-Key: zk_live_your_institutional_key_here
3. Rate Limiting & Throttling
The API uses a Redis-backed token bucket algorithm to enforce fair usage limits per key. The standard limits are:
- Standard Institutional Keys: 60 requests per minute
- Discovery Cluster Nodes: 300 requests per minute
Each response includes standard headers indicating current quota status:
| Header | Description |
|---|---|
| X-RateLimit-Limit | The maximum number of requests allowed in the current window. |
| X-RateLimit-Remaining | The number of remaining requests allowed before blocking. |
| X-RateLimit-Reset | Unix epoch time indicating when the current window resets. |
4. Endpoint References
Evaluates biological sequences or epigenetic datasets for oncogenic safety compliance and calculates true biological age using the 353-CpG Horvath Epigenetic Clock model coefficients.
{
"factors": [
"GATA4",
"TBX5",
"OCT4"
],
"cpg_methylation": {
"cg00000292": 0.12,
"cg00002033": 0.85,
"cg00005847": 0.04
}
}
{
"status": "success",
"data": {
"approved_factors": [
"GATA4",
"TBX5",
"OCT4"
],
"blocked_factors": [
"c-MYC"
],
"sirtuin_engagement": {
"pathway_score": 0.82,
"targeted_sirtuins": [
"SIRT1",
"SIRT6"
]
},
"horvath_clock_impact": {
"predicted_biological_age": 42.15,
"probes_matched": 120,
"probes_defaulted": 233,
"total_clock_probes": 353
},
"safety_summary": "Passed pioneer safety gate. OSK partial mode active. Blocked oncogene: c-MYC."
},
"meta": {
"model_version": "zenith-v31.0",
"credits_used": 1,
"compute_time_ms": 12
}
}
Folds the provided amino acid sequence using Nilus Atomix, returning 3D atomic coordinates in standard Protein Data Bank (.pdb) output structure.
{
"sequence": "MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE"
}
{
"status": "success",
"data": {
"source": "Nilus Atomix-Live",
"fallback_used": false,
"provider": "Nilus Atomix",
"provider_status": "ok",
"sequence_length": 105,
"pdb_data": "HEADER PROTEIN BINDING 02-JUL-26\nTITLE ESMFOLD PREDICTED STRUCTURE\nATOM 1 N MET A 1 12.420 15.106 23.840 1.00 85.00 N\nATOM 2 CA MET A 1 13.500 14.280 24.120 1.00 85.00 C\n...",
"metrics": {
"length": 105,
"compute_time_sec": 1.25,
"predicted_lddt": 85.0,
"confidence_source": "pLDDT/B-factor-derived"
},
"cache_hit": false,
"scientific_limitations": [
"Single-sequence structure prediction only",
"Not ZenithFold",
"Not AlphaFold3",
"Not ligand-aware",
"Not validated for clinical use"
]
},
"meta": {
"credits_used": 10,
"compute_time_ms": 1250
}
}
Queries live datasets from the Chan Zuckerberg Cellxgene Census, feeds the expression vectors into the scVI specialist models, executes transcriptomic perturbations, and prepares results in standard AnnData format.
{
"baseline_cell_type": "ventricular_myocyte",
"perturbation_factors": {
"GATA4": 1.5,
"SIRT1": 2.0
},
"census_filter": "tissue_general == 'heart' and disease == 'normal'"
}
{
"job_id": "job_01h26c483aefd28e",
"status": "pending",
"status_url": "https://niluslab.com/api/v1/jobs/job_01h26c483aefd28e",
"eta_seconds": 6.0
}
Simulates lipid nanoparticle encapsulation models to optimize structural targeting efficiency for heart tissues.
{
"molar_ratios": {
"ionizable": 0.50,
"helper": 0.10,
"cholesterol": 0.385,
"peg": 0.015
},
"np_ratio": 6.0,
"active_ligand_conjugation": true,
"ligand_density": 2.5,
"peg_mw": 2000.0
}
{
"status": "success",
"data": {
"circulation_half_life_hours": 12.5,
"heart_selectivity_score": 0.88,
"liver_sequestration_score": 0.12,
"endosomal_escape_percent": 34.2,
"particle_size_nm": 82.5,
"zeta_potential_mv": -14.2,
"encapsulation_efficiency_percent": 94.2,
"cytotoxicity_index": 0.15,
"formulation_status": "OPTIMAL",
"delivery_mechanism": "receptor_mediated_endocytosis",
"mechanism_note": "Targeted ApoE-mediated receptor path verified."
},
"meta": {
"model_version": "zenith-v31.0",
"credits_used": 1,
"compute_time_ms": 45
}
}
Subscribes callback URLs to real-time async job completion notifications. All triggers are dispatched with an HMAC-SHA256 signature calculated against the payload.
{
"url": "https://your-institutional-server.edu/webhooks/zenith"
}
{
"status": "success",
"data": {
"subscription_id": 1,
"url": "https://your-institutional-server.edu/webhooks/zenith",
"signing_secret": "whsec_your_hmac_signing_secret_here",
"status": "active",
"created_at": "2026-07-01T04:19:38.256Z"
},
"meta": {
"model_version": "zenith-v31.0",
"credits_used": 0,
"compute_time_ms": 5
}
}
Retrieves the status of an asynchronous simulation job. If completed, provides download capability for the target AnnData .h5ad binary payload.
{
"status": "success",
"data": {
"job_id": "job_01h26c483aefd28e",
"status": "running",
"status_url": "https://niluslab.com/api/v1/jobs/job_01h26c483aefd28e",
"eta_seconds": 6.0
},
"meta": {
"model_version": "zenith-v31.0",
"credits_used": 0,
"compute_time_ms": 1
}
}
{
"status": "success",
"data": {
"job_id": "job_01h26c483aefd28e",
"status": "completed",
"filepath": "/tmp/job_01h26c483aefd28e.h5ad",
"result": {
"cell_count": 50,
"genes_count": 5009,
"source_dataset": "HCA Specialist (486k cells)",
"download_url": "/api/v1/jobs/job_01h26c483aefd28e/download"
}
},
"meta": {
"model_version": "zenith-v31.0",
"credits_used": 0,
"compute_time_ms": 1
}
}
5. Webhook HMAC-SHA256 Signature Verification
To prevent replay and spoofing attacks, Zenith signs all webhook callback requests with a cryptographic HMAC-SHA256 signature calculated against the raw request body payload bytes using the secret key returned at subscription time.
The signature is transmitted in the header:
X-Zenith-Signature: 6e9e4f21...
To verify the payload, calculate the HMAC signature directly against the request body using the raw secret key. Below is the complete, production-ready Python verification snippet:
import hmac
import hashlib
def verify_signature(payload_body: bytes, signature_header: str, secret_key: str) -> bool:
"""
Verifies the Zenith HMAC-SHA256 signature calculated against the raw payload bytes.
"""
# 1. Compute local HMAC-SHA256 hash using the secret key
computed_sig = hmac.new(
secret_key.encode('utf-8'),
payload_body,
hashlib.sha256
).hexdigest()
# 2. Compare signature arrays in constant-time
return hmac.compare_digest(computed_sig, signature_header)
6. SDK Integration Examples
Python Pipeline Integration
Complete script to launch a cell perturbation simulation, poll until completion, download the `.h5ad` file, and load it into Scanpy/AnnData:
import time
import requests
import anndata as ad
API_KEY = "zk_live_your_key_here"
BASE_URL = "https://niluslab.com/api/v1"
HEADERS = {"X-API-Key": API_KEY}
def run_cohort_perturbation():
# 1. Launch the async simulation job
payload = {
"baseline_cell_type": "ventricular_myocyte",
"perturbation_factors": {"GATA4": 1.5, "SIRT1": 2.0},
"census_filter": "tissue_general == 'heart' and disease == 'normal'"
}
res = requests.post(f"{BASE_URL}/predict/perturbation", headers=HEADERS, json=payload)
job = res.json()
job_id = job["job_id"]
print(f"Launched job {job_id}. Polling status...")
# 2. Poll until completed
while True:
status_res = requests.get(f"{BASE_URL}/jobs/{job_id}", headers=HEADERS)
status_data = status_res.json()
status = status_data["data"]["status"]
if status == "completed":
break
elif status == "failed":
raise Exception("Calculation failed on computing cluster.")
print(f"Job status: {status}... waiting.")
time.sleep(2)
# 3. Stream binary AnnData download
download_url = status_data["data"]["result"]["download_url"]
file_path = f"perturbation_{job_id}.h5ad"
# Prepend base domain if url returned is relative
if download_url.startswith("/"):
download_url = f"https://niluslab.com{download_url}"
with requests.get(download_url, headers=HEADERS, stream=True) as stream:
stream.raise_for_status()
with open(file_path, 'wb') as f:
for chunk in stream.iter_content(chunk_size=8192):
f.write(chunk)
print(f"Successfully downloaded results to {file_path}")
# 4. Read matrix into AnnData
adata = ad.read_h5ad(file_path)
print(f"Matrix Dimension: {adata.shape}")
print(adata.X[:5, :5])
if __name__ == "__main__":
run_cohort_perturbation()
JavaScript / Node.js Integration
Node.js script using fetch syntax to request Nilus Atomix structure coordinates:
const apiKey = 'zk_live_your_key_here';
const baseUrl = 'https://niluslab.com/api/v1';
async function fetchProteinFold(sequence) {
try {
const response = await fetch(`${baseUrl}/structure/fold`, {
method: 'POST',
headers: {
'Content-Type': 'application/json',
'X-API-Key': apiKey
},
body: JSON.stringify({ sequence })
});
const envelope = await response.json();
if (envelope.status === 'success') {
console.log('Coordinates loaded:');
console.log(envelope.data.pdb_data.substring(0, 500) + '\n...');
} else {
console.error('Nilus Atomix failed:', envelope);
}
} catch (err) {
console.error('Request Error:', err);
}
}
fetchProteinFold('MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFG');
Raw cURL Shell Execution
Raw HTTP commands to query formulation optimizations:
curl -X POST "https://niluslab.com/api/v1/lnp/optimize" \
-H "X-API-Key: zk_live_your_key_here" \
-H "Content-Type: application/json" \
-d '{
"molar_ratios": {
"ionizable": 0.50,
"helper": 0.10,
"cholesterol": 0.385,
"peg": 0.015
},
"np_ratio": 6.0,
"active_ligand_conjugation": true,
"ligand_density": 2.5,
"peg_mw": 2000.0
}'